PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa001931
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family LBD
Protein Properties Length: 216aa    MW: 23790 Da    PI: 8.2098
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58674944PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260140.17.1e-44161151100
     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                +CaaCk+lrrkC+++Cv+apyfp +qp+kfanvhk+FGasnv k+l++l+ ++reda++sl+yeA+ar+rdPvyG+vg+i+ lq++l+q++ +l+ +k+e
  Lsa001931  16 PCAACKFLRRKCTQECVFAPYFPPDQPQKFANVHKVFGASNVAKILNELSATQREDAVNSLAYEADARLRDPVYGCVGLISILQHRLRQVQIDLENAKRE 115
                7*********************************************************************************************999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.8815116IPR004883Lateral organ boundaries, LOB
PfamPF031952.8E-4316113IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 216 aa     Download sequence    Send to blast
MYAVVKVKEK MSSNSPCAAC KFLRRKCTQE CVFAPYFPPD QPQKFANVHK VFGASNVAKI  60
LNELSATQRE DAVNSLAYEA DARLRDPVYG CVGLISILQH RLRQVQIDLE NAKRELANYI  120
GPSAMLPILN QGFIQQSALP YNMQPEPVLG LTGPRSFREV QQILQDHQQQ IGVTNGERGH  180
PEVIRNYDQQ RSSGDHLGFS GGFDAVSAAS GQVSGG
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009600700.13e-83PREDICTED: LOB domain-containing protein 36-like isoform X2
SwissprotQ9FKZ37e-74LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A103YH601e-118A0A103YH60_CYNCS; Lateral organ boundaries domain-containing protein
STRINGPGSC0003DMT4000020135e-76(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.11e-74ASYMMETRIC LEAVES 2-like 1